PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT07151
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family NAC
Protein Properties Length: 411aa    MW: 44339.7 Da    PI: 6.6739
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT07151genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1583.9e-49461712128
       NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvgl 102
               +pGfrFhPt+eel+ +yL++kveg+++++ e i+ +d+y+++Pw+Lp+++  +ekew+f+++rd+ky++g+r+nr+t+sgyWkatg d+ +  ++++ +gl
  EMT07151  46 MPGFRFHPTEEELIEFYLRRKVEGRRFNV-ELITFLDLYRFDPWELPAMAVIGEKEWFFYVPRDRKYRNGDRPNRVTASGYWKATGADRMIRGENSRPIGL 145
               79***************************.89***************7777899*********************************************** PP

       NAM 103 kktLvfykgrapkgektdWvmheyrl 128
               kktLvfy+g+apkg++++W+m+eyrl
  EMT07151 146 KKTLVFYSGKAPKGVRSSWIMNEYRL 171
               ************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.96E-5445215IPR003441NAC domain
PROSITE profilePS5100553.53545216IPR003441NAC domain
PfamPF023651.7E-2447171IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 411 aa     Download sequence    Send to blast
MSRDVDEGSV SAATAGAGGG GEVGGEAAAG VSDEAAVDSH ENDLVMPGFR FHPTEEELIE  60
FYLRRKVEGR RFNVELITFL DLYRFDPWEL PAMAVIGEKE WFFYVPRDRK YRNGDRPNRV  120
TASGYWKATG ADRMIRGENS RPIGLKKTLV FYSGKAPKGV RSSWIMNEYR LPPPTTDADL  180
FYKGGFDRAC LCSLSEVSQN VSCMQSEISL CRVYKRSGID DGHGRPSSSN VQASSSARPG  240
TSRTIIPPAG QQVSSPLSTP MSPTQQPSFH GILGQGECSP APLPAIMDQA TAQLHQPPPP  300
PPPRPSAFAS AMSSTMSVAP AARSCTYSLM ALADAPMMGS SSTPGDELSR LVGHSQAYPN  360
HPAVGSHFLP SPSSSQIPPH GEMPVSPADK LWDWIHPDTT GSRDYGSSSF K
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-534721719166NAC domain-containing protein 19
4dul_A2e-534721719166NAC domain-containing protein 19
1ut7_B2e-534721719166NO APICAL MERISTEM PROTEIN
1ut7_A2e-534721719166NO APICAL MERISTEM PROTEIN
1ut4_B2e-534721719166NO APICAL MERISTEM PROTEIN
1ut4_A2e-534721719166NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010231368.11e-155PREDICTED: protein FEZ isoform X2
TrEMBLM8AZH80.0M8AZH8_AEGTA; Putative NAC domain-containing protein 94
STRINGMLOC_69621.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP28263787
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02450.22e-92NAC domain containing protein 35